SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN18645 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN18645
Domain Number 1 Region: 6-102
Classification Level Classification E-value
Superfamily POZ domain 6.02e-32
Family Tetramerization domain of potassium channels 0.00000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN18645   Protein: CN02613   Gene: WBGene00157370
Sequence length 242
Comment CN02613 WBGene00157370 locus:Cbn-shw-3 status:Predicted
Sequence
MDSEYRIILNVGGVRHETYKHTLKKIPATRLSRLTTNLANYDPVLNEYFFDRHPGVFAQI
LNYYRTGKLHYPLDVCGPLFEEELKYWGLDSNECEPCCWMTLSGTRDTQDVLKTLDELDI
EVDQTEGPELYKRFGWEDDYHNDSLSAWQKLKPRIWRLFDEPNSSRSAQFIAAISVFFLI
TAIIVFCLKTHPGLRIPELAPFGNFSRNHRSTSSRIHPAQINIDKQNSRPHPTFMVLYRN
NL
Download sequence
Identical sequences G0N977
135651.CBN18645 CBN18645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]