SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN20155 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN20155
Domain Number 1 Region: 5-51
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 4.97e-16
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.001
Further Details:      
 
Domain Number 2 Region: 54-105
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.0000000000000133
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN20155   Protein: CN23599   Gene: WBGene00158880
Sequence length 115
Comment CN23599 WBGene00158880 status:Confirmed
Sequence
MEKPNYQLYRNTTLGQALQKTLDDFISEQLIPESLSKKVMDSFDKSINRILPMKAKNKVN
FRADKLRAYRYCDNVWTFIVEQVDLRDAVEGGTVARLKIVACDGQSTKGQLQGHS
Download sequence
Identical sequences G0NI56
135651.CBN10283 135651.CBN20155 CBN10283 CBN20155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]