SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN22950 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN22950
Domain Number 1 Region: 31-126
Classification Level Classification E-value
Superfamily POZ domain 0.000000353
Family BTB/POZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN22950   Protein: CN00174   Gene: WBGene00161675
Sequence length 219
Comment CN00174 WBGene00161675 status:Partially_confirmed
Sequence
MTSAQQVSVPDGLQDKINLFKTATVLRKFQIDTQSDTIYVNLNYLAELSEYFHVLRTGSY
TEKSTEKVNLDDVFTEELVVFLSYVCPEGFEFDRTINNQNISSLVYFSDRLIFPWIKQEI
KKYLKSDEFKDEQYDTELLIQLCYLLHAQCYPSADIDPVFKKIARLSDIASVDKALATVT
DKDTQVLFNERIIYFRPYTFQPRPQSFFDWNDNRARLFF
Download sequence
Identical sequences G0MHL5
CBN22950 135651.CBN22950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]