SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN25624 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN25624
Domain Number 1 Region: 297-353
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 4.71e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00035
Further Details:      
 
Domain Number 2 Region: 5-47
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000445
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN25624   Protein: CN17547   Gene: WBGene00164349
Sequence length 353
Comment CN17547 WBGene00164349 locus:Cbn-pqn-51 status:Partially_confirmed
Sequence
MSHGNGIAEIYKSVIADVINNMKEAFLDENIDVDVLSQLKKEWEDKVNSSGCVDLDSNVP
PPAPRQQPQQQQHIPVAPIRPNPLPNRMAQNIQQHPGRSTMATLQAAQLGESPIRMSYAG
QQGQHPQAVRMLPQQFQGGNMSFGGPQFVVVQQPGGVPMVMPNNFQQRLVHQQQPSQQQQ
GNQLTHMNQMDGNGGSESEGEGCSEPLSVRQKKAKASLKVRGTGASQKKAMKVLGSMLKE
IQLDGGGGGMSDSSSDDEAEDDDDPLRRIADRMGNGEVEDGDQVAEEEPLNSEDDQSDDE
DLTQLFDADNIVMCQFEKVNRARTKWKFQLKDGIMHIDKKDYCFQKCTGEAEW
Download sequence
Identical sequences G0MS72
135651.CBN25624 CBN25624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]