SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN00414 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN00414
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily PapD-like 6.28e-27
Family MSP-like 0.00000544
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN00414   Protein: CN14091   Gene: WBGene00139139
Sequence length 160
Comment CN14091 WBGene00139139 status:Predicted
Sequence
MALTADPQACTVPAAGGASTHKLVNAGAEKLVFKIKSSNNKEYRVSPVFGFIDPSGSKDL
TITRNAGAPKEDKLVIYFGPAPADATDAQAAFGAITPAGTVTIPLSATEEVMTDLEPELE
KLDLETEEDEESNTFTDNNDFEFDDSGESMSSVSRNSEVR
Download sequence
Identical sequences G0P1I2
135651.CBN00414 CBN00414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]