SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN00904 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN00904
Domain Number 1 Region: 4-100
Classification Level Classification E-value
Superfamily PapD-like 3.4e-22
Family MSP-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN00904   Protein: CN26058   Gene: WBGene00139629
Sequence length 115
Comment CN26058 WBGene00139629 status:Confirmed
Sequence
MGVELSLDPPVCPIQANGGTSKHKIINHCDKMLAYKVKSSNNSNYSVNTIYGLIQIGYTA
DLIITRKPGKPQADRLVIQFASVEQTCRDPKAPFATGQPVGELCGETIIKLSAAE
Download sequence
Identical sequences A0A2G5UUS2 G0NNW3
CBN00904 135651.CBN00904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]