SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN01321 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN01321
Domain Number 1 Region: 11-128
Classification Level Classification E-value
Superfamily PapD-like 3.92e-16
Family MSP-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN01321   Protein: CN22794   Gene: WBGene00140046
Sequence length 341
Comment CN22794 WBGene00140046 status:Predicted
Sequence
MATTTVALVPDLSKVVFNPSKSVTFVPTEKKQAVKVEITNHSTSDVAIKFKNTGPMFFKT
MPNVAKIAVGEKKTFVCVFKGASKDKCKDNERFTIVVLAASKNAVTDKAFKNAHKSATMK
HKIFILFQGINDQKENEPQQPTNNEEEDDKDRKGQMRAKSKVDTTKKATVVMFMRKEGDS
LSDEEGEEGTSPAADGAGPPSDDMMTTRPAGNFTGQVASNESAGAPAAGAPKSEFRTTRP
AGAFTGQVASNEALGGGPPGTPKSEFRTTRPAGNFTGQVAAAPVPGTPVDPQSNGLRTTR
PAGAYNNQVTPNADGGAGGTQGLKTTKPAGSYENPQRSNNK
Download sequence
Identical sequences G0MK14
CBN01321 135651.CBN01321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]