SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN01758 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN01758
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily PapD-like 7.33e-28
Family MSP-like 0.00000391
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN01758   Protein: CN26320   Gene: WBGene00140483
Sequence length 109
Comment CN26320 WBGene00140483 status:Confirmed
Sequence
MSLTADPPACTVPAAGGTSTHKLVNAGADKLVFKIKSSNNNEYRISPVFGFIDPSGSKDV
TITRTAGAPKEDKLVIHFGPAPADATDAQAAFGAITPAGTVTIPLSATA
Download sequence
Identical sequences G0MPX9
135651.CBN01758 CBN01758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]