SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN02332 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN02332
Domain Number 1 Region: 30-183
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.13e-25
Family Calponin-homology domain, CH-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 1284-1383
Classification Level Classification E-value
Superfamily RGC domain-like 5.36e-21
Family RGC domain 0.0015
Further Details:      
 
Domain Number 3 Region: 757-1089
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000141
Family p120GAP domain-like 0.0079
Further Details:      
 
Weak hits

Sequence:  CBN02332
Domain Number - Region: 202-485
Classification Level Classification E-value
Superfamily ARM repeat 0.00825
Family Mo25 protein 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN02332   Protein: CN22530   Gene: WBGene00141057
Sequence length 1383
Comment CN22530 WBGene00141057 status:Predicted
Sequence
METDHHHENGLPSPATSENVEDVDERRLNRVAYEYLCRCEEVRTWLSECLKDDSIASITE
LEENLRNGVLLARLGNSFAPEIVPEKGIFDIKQEKYKQNESVPVYRHSDNIMQWRRAMES
VRLPEIFIPETADVFEGRNMKTVFCLFALATLLHRQRKAPPMRNLAGKAKFSVTELGAAK
ENLKDSKLPEFGDVGSMLSDRKNDANAQALAMETLREAVNEKDAQKVLEVLKSAPASIDY
VEESLAEHYLNGLAEQMKEDEKLTKIYVQSVVNSENNKSAMEQLDALLSQESSDPHALIH
ILDLLQIEDVRQFATSLYIELLRKSPKSTSDDVRDIISHANALVEVKIAVEHGSSEDVLK
SLLNPHLNLAQDVEKSNTKLYSNRLKKEYETLSDDQEFLLQEQLAEIVREYSSISPERRQ
ILELNGALQRGDSEGVEIILRSISFDFYIEENLDFYSRKLGQKKPGSMEDVKDLMKETNQ
EVQEAFKLADTVVEINKAKTEKEIQKILKTLPNSEEFREELVHWYSKKFSDELQKHPEHA
PEGWLDHEFSLGTVYVKSDDKTHSTTSQSPLHPTFLRWNSTLLPLIRTENSNFDEYWKEK
EREVVKGQSVFRKLLNAKKAAKEAELKKEQEEAAAKIQSHYKVYRNRKDLELLRTTSTPS
LSLVRKFVNQLPRGEVDFSDDLEVAESKTEVSRLMASNRQLDKNLEEMDENIGLLIKNRL
NLQEVIAHRDKTVVSAEDFAAKSEVSNKKQREKSSVESLEQLLYYLQTKPNYLANLIENL
RENRTEVMTEVVSPIFGFLSDNREQFLLVRLLCELMGRNIAQLRLIEDFQSNYFMQATAE
TVKLSTFDNILSDPCQSIIEELTNFIDEESRVKTFHLDPMELYKSLYGRPVESAEKALQD
TAVSDILSSSISFLAKWSERFMNAIFESFKLPKSCVYMTSYLETALRHQFPAATAMQIDQ
TVAMFAFKVFVSHHLTSPRSLFRALGKSITDDATHRLEAIIHFTENAVANKGYANKMWFL
SLLNANVHTIHKKFIEYINLNVRNVALDEVYSMNEFTQFDPFHKPTLSLIDKHLQTVIEC
LRKHKNDISEGAEDQIAHLIESVDDVVTSDGVVMLQLHPSPNEMLPDGTQAHLFTRAKKQ
VVELLLEEVEGNDVEQLVEQKKNVTPALQTIQTDLKTDLRQLEEDGRTTQSDKYQSIVTD
IANDIRLHERRQRERQEQKKSIAATRRKLMEQREELNEKLARYEEYLETCLQNLSRTSRR
LSFRPNTKEAGKIQKERASLDQIKSYKSSAEKLFRKGIIKSIIGYQTPKRISKLSVEIAS
TEEGGVFSMVLVEGKTPVGNAILHFQDLLKADSVEEPTYTLIDMVVLDVQKAIQYINKKF
YNK
Download sequence
Identical sequences G0PIM2
CBN02332 135651.CBN02332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]