SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN02368 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN02368
Domain Number 1 Region: 30-183
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-25
Family Calponin-homology domain, CH-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 1284-1383
Classification Level Classification E-value
Superfamily RGC domain-like 6.54e-21
Family RGC domain 0.0016
Further Details:      
 
Domain Number 3 Region: 757-1089
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000204
Family p120GAP domain-like 0.0079
Further Details:      
 
Weak hits

Sequence:  CBN02368
Domain Number - Region: 202-485
Classification Level Classification E-value
Superfamily ARM repeat 0.00705
Family GUN4-associated domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN02368   Protein: CN00037   Gene: WBGene00141093
Sequence length 1383
Comment CN00037 WBGene00141093 status:Predicted
Sequence
METDQHHENGLPSPATSENVEDVDERRLNRVAYEYLCRCEEVRTWLSECLKDDSIASITE
LEENLRNGVLLARLGHSFAPEIVPEKGIFDIKQEKYKQNESVPVYRHSDNIMQWRRAMES
VRLPEIFIPETADVFEGRNMKTVFCLFALATLLHRQRKAPPMRNLAGKAKFSVTELGAAK
ENLKDSKLPEFGDVGSMLSDRKNDANAQALAMETLREAVNEKDAQKVLEVLKSAPASIDY
VEESLAEHYLNGLAEQMKEDEKLTKIYVQSVVNSENNKSAMEQLDALLSQESSDPHVLIH
ILDLLQIEDVRQFATSLYIELLRKSPKSTSDDVRDVISHANALVEVKIAVEHGSSEDVLK
SLLNPHLNLAQEVEKSNAKLYSNRLKKEYETLSDDQEFLLQEQLAEIVREYSSISPERRQ
ILELNGALQRGDSEGVEVILKTISFDFYIEENLEFYSRKLGQKKPGSMDDVKDLMKETNQ
EVQEAFKLADTVVEINKAKTEKEIQKILKTLPNSEDFREELVHWYSKKFSDELQKHPEDA
PEGWLDHEFSLGTVYVKSDNKAHSTTSQSPLHPTYLRWNLTLLPLIHTENSNFDEYWKEK
EKEVVKGQSVFRKLLNAKKAAKEAELKKEQEEAAAKIQSHYKVYRNRKDLELLRTTSTPS
LSLVRKFVNQLPRGEVDFSDDLEVAESKTEVSRLMASNRQLDKNLEEMDENIGLLIKNRL
NLQEVIAHRDKTVVSAEDFAAKSEVSNKKQREKSSVESLEQLLYYLQTKPNYLANLIENL
RENRTEVMTEVVSPIFGFLSDNREQFLLVRLLCELMGRNIAQLRLIEDFQSNYFMQATAE
TVKLSTFDNILSDPCQSIIEELTNFIDEESRVKTFHLDPMELYKSLYGRPVESAEKALQD
TAVSDILSSSISFLAKWSERFMNAIFESFKLPKSCVYMTSYLETALRHQFPATTAMQIDQ
TVAMFAFKVFVSHHLTSPRSLFRALGKSITDDATHRLEAIIHFTENAVANKGYANKMWFL
SLLNANVHTIHKKFIEYINLNVRNVALDEVYSMNEFTQFDPFHKPTLSLIDKHLQTVIEC
LRKHKNDISEGAEDQIVHLIESVNDVVTSDGVVMLQLHPSPNEMLPDGTQAHLFTRAKKQ
VVELLLEGVEGNDVEQLVEQKKNVTPALQTIQIDLKTDLRQLEEDGRTTQSDKYQSIVTD
IANDIRLHERRQRERQEQKKSIAATRRKLMEQREELNEKLARYEEYLETCLQNLSRTSRR
LSFRPNTKEAGKIQKERASLDQIKSYKSSAEKLIRKGIIKSIIGYQTPKRISKLSVEIAS
TEEGGVFSLVLVEGKTPVGNAILHFQDLLKADSVEEPTYTLIDMVVLDVQKAIQYINKKF
YNK
Download sequence
Identical sequences G0MIX9
135651.CBN02368 CBN02368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]