SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN03080 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN03080
Domain Number 1 Region: 105-176
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 5.23e-19
Family Skp1 dimerisation domain-like 0.00045
Further Details:      
 
Domain Number 2 Region: 23-90
Classification Level Classification E-value
Superfamily POZ domain 8.24e-17
Family BTB/POZ domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN03080   Protein: CN01813   Gene: WBGene00141805
Sequence length 201
Comment CN01813 WBGene00141805 status:Predicted
Sequence
MSVENAPVVDVDEAAIPVEKKMYYRFESNDKKEFRVSELAIQQSETLNRLVEAMGYTSED
VENKPAIAIENIDGKTLKLVFQWCEHHKGEAIPVDDGSVPKIVEIPEFDAKLMDIDNGLL
FKLIWAADYLNIVQLLNVSCKKVANMAQGKTPAQLRRVYLLPSDEEDEAAKRAAQEAQDP
RAREVEEEFEERKRQGGNSFF
Download sequence
Identical sequences G0NL14
CBN03080 135651.CBN03080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]