SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN03838 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN03838
Domain Number 1 Region: 10-123
Classification Level Classification E-value
Superfamily PapD-like 1.09e-21
Family MSP-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN03838   Protein: CN24410   Gene: WBGene00142563
Sequence length 262
Comment CN24410 WBGene00142563 status:Predicted
Sequence
MLPRPMRPINGDVESKHFELKLGSPILYFENPRCGWYYTPAKVFIKNPTKDRYTYKVKCT
NNQMFDIQAPVGFIEPEESVDVEVFHCPGFFIPENDSHHLSVYYIKCDKEAKDYSPIWRS
KKAEGCKHVHIRFPKQIIMTVQQKKDWDAKIKEERRVERARKMIARREEDEVEKERRALV
LKEKEEAAEQKKREAEERKKEREKKKKEEENKNKKEEKKEEKKEEKKEEKKEEKKAEEPV
KKETTKTEEKKEEDEKAGEKKE
Download sequence
Identical sequences G0MGF2
CBN03838 135651.CBN03838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]