SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN03887 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN03887
Domain Number 1 Region: 101-168
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 6.15e-22
Family Skp1 dimerisation domain-like 0.0004
Further Details:      
 
Domain Number 2 Region: 19-87
Classification Level Classification E-value
Superfamily POZ domain 2.22e-16
Family BTB/POZ domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN03887   Protein: CN05995   Gene: WBGene00142612
Sequence length 171
Comment CN05995 WBGene00142612 status:Confirmed
Sequence
MSAEAAPLVADAPIEDGMYFRIKSKDGVEFKVSELAIQQSETLCHLFHAMDYTSEDVRTR
AAIPLEDIDGETLKLVFKWCEHHKGAPIPVEDDADPKNVVIPEFDSKLMEIDDEQLFNLI
CAANYLNIKRLMNVACKKVSNMAKGKSPEELRIIYGIPTDEEDEAAKRAAE
Download sequence
Identical sequences G0MZ26
CBN03887 135651.CBN03887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]