SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN04469 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN04469
Domain Number 1 Region: 24-125
Classification Level Classification E-value
Superfamily PapD-like 0.0000000262
Family MSP-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN04469   Protein: CN27025   Gene: WBGene00143194
Sequence length 166
Comment CN27025 WBGene00143194 status:Predicted
Sequence
MKVAEKKVKSSAELSIAKLNCTSPERDLIVYPRWLCFNSQNGFKTPLFVRFFVENREPYP
VTYNVKSREKIFRVDSSCGILKTGERKTIKLYLISSDDWPLSIVEYTQKRIKVAVECLRL
PDHIDPKTAKDSSMMAKIIWKRSFNEWPLERLYTKVYCIFQFQFNQ
Download sequence
Identical sequences G0P6D9
CBN04469 135651.CBN04469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]