SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN05052 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN05052
Domain Number 1 Region: 100-171
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 6.41e-24
Family Skp1 dimerisation domain-like 0.00036
Further Details:      
 
Domain Number 2 Region: 19-85
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000973
Family BTB/POZ domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN05052   Protein: CN30809   Gene: WBGene00143777
Sequence length 178
Comment CN30809 WBGene00143777 status:Partially_confirmed
Sequence
MSAEAAPLVADAPVEDGMYYRIESNDGVEFKVSELSIIQQSVILSLLVQNYTLEDVRTRD
AIHIEKFDSGTLQLVFEWCEHHKGEAIPEDDDSVPKNVEITEFDARLMEIDNEQLFHLIC
AANYLNIKQLLNVSCKKVANMAKGKSPEELRIIFEIPTDEEDEAEERAALEAQRRDAE
Download sequence
Identical sequences G0NL59
135651.CBN05052 CBN05052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]