SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN05696 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN05696
Domain Number 1 Region: 94-169
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.07e-32
Family Skp1 dimerisation domain-like 0.0000133
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily POZ domain 1.02e-20
Family BTB/POZ domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN05696   Protein: CN11921   Gene: WBGene00144421
Sequence length 171
Comment CN11921 WBGene00144421 status:Confirmed
Sequence
MTETAAAERNIKISSSDNEVFMVPRNVIRLSTTINTLLQDLGLDEDDSTNPEPIPVQNVT
APILKKVIAWCQYHYQDAAPTDDSDNREKRTDDIASWDVEFLKVDQGTLFELILAANYLD
IKGLLDVTCKTVANMIKGKSPEEIRRTFNIKNDFTPEEEEQIRKENAWCED
Download sequence
Identical sequences G0PCG7
CBN03973 CBN05696 135651.CBN03973 135651.CBN05696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]