SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN06348 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN06348
Domain Number 1 Region: 94-159
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000000000000772
Family Skp1 dimerisation domain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 16-83
Classification Level Classification E-value
Superfamily POZ domain 0.000000196
Family BTB/POZ domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN06348   Protein: CN07139   Gene: WBGene00145073
Sequence length 163
Comment CN07139 WBGene00145073 status:Predicted
Sequence
MSSNIPNLPNGPSNLTYQLISKDKTIVPISNQSLTHLKVVSQMVNTFQYTQEQINQVGPI
PVNTNDSTLCQIVEWANRHRLNPVPESTNGLEQVKVPAWDRGFLQRVDETCGLYNIACAS
NFLDMPMLQHYIAVLIAEKARGKSPEQLKKIFMIPGDTEDAAI
Download sequence
Identical sequences G0N869
135651.CBN06348 CBN06348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]