SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN06434 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN06434
Domain Number 1 Region: 22-156
Classification Level Classification E-value
Superfamily PapD-like 1.51e-25
Family MSP-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN06434   Protein: CN11624   Gene: WBGene00145159
Sequence length 157
Comment CN11624 WBGene00145159 status:Predicted
Sequence
MSTPSKPPTPLPFADAGPSDDVAMRNKSDEPPFKLWMNMKQIDFPYTPPGKSTSVILRLH
NPTATRITFKIRCTSADIFRVQPPVAFINPNGTMNITIWCSNTTQPLEKLEKRHYFAFYH
KTASPNHRQAPPLWKDLKEAEGVRRIPVNFLSSTQPP
Download sequence
Identical sequences G0N179
CBN06434 135651.CBN06434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]