SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN06862 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN06862
Domain Number 1 Region: 97-159
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 8.11e-22
Family Skp1 dimerisation domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 20-85
Classification Level Classification E-value
Superfamily POZ domain 1.44e-16
Family BTB/POZ domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN06862   Protein: CN18738   Gene: WBGene00145587
Sequence length 182
Comment CN18738 WBGene00145587 status:Predicted
Sequence
MVLFGNESSSKVDKNLDDCFILVSSDKKEFPISQQAIKHSKTLAQMISTLNISTNSDEKR
IPVENVQGEHLDLIVQWCEHHKEEPVLEDEKAIDQDFKIPDWDRTFLEVDNETLFHFICA
ANYLDIELLMIMACKTVALMAKGRTPEEMRIIFGVNVDEEEQLMMHTNTAPQVEIVEAER
EE
Download sequence
Identical sequences G0PBC9
CBN06862 135651.CBN06862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]