SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN06954 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN06954
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily PapD-like 1.18e-27
Family MSP-like 0.00000434
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN06954   Protein: CN11993   Gene: WBGene00145679
Sequence length 109
Comment CN11993 WBGene00145679 status:Predicted
Sequence
MSLTADPPACTVPAAGGASTHKLMNAGADKLVFKIKSSNNNEYRISPVFGFIDPSGSKDI
TITRTAGAPKEDKLVIHFAPAPADATDPQAAFGAVTPAGTVTIPVSATA
Download sequence
Identical sequences G0P9V7
CBN06954 135651.CBN06954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]