SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN07576 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN07576
Domain Number 1 Region: 84-148
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 8.11e-18
Family Skp1 dimerisation domain-like 0.00078
Further Details:      
 
Domain Number 2 Region: 9-75
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000153
Family BTB/POZ domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN07576   Protein: CN22254   Gene: WBGene00146301
Sequence length 173
Comment CN22254 WBGene00146301 locus:Cbn-skr-20 status:Predicted
Sequence
MSVPLPRALYKLKSEDGQIFMVERIPMKYSSFINQKFIDLGINDRNCDKVDPILVPCHSS
AFEKIIEWLYHHQHKYPSGLDCRYADLDDWDKEFFKMQSGELFELISATHSLGIKEMMNM
GCSAAAQLINGKSTKEMREILGIRTDEERMELALANGGEGSSTTSFVVDKNFN
Download sequence
Identical sequences G0MBK6
135651.CBN07576 CBN07576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]