SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN07912 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN07912
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily PapD-like 8.22e-29
Family MSP-like 0.00000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN07912   Protein: CN16016   Gene: WBGene00146637
Sequence length 109
Comment CN16016 WBGene00146637 status:Confirmed
Sequence
MSLTADPPACTVPAAGGTSTHKLVNAGAEKMIFKIKSSNNNEYRISPVFGFVDPSGSKDI
TITRTAGAPKEDKLVIHFAVAPPEATDAQAAFSAITPAGTVTIPMSATA
Download sequence
Identical sequences G0NZ93
CBN07912 135651.CBN07912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]