SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN08140 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN08140
Domain Number 1 Region: 1328-1726
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.23e-132
Family Reverse transcriptase 0.0000167
Further Details:      
 
Domain Number 2 Region: 1918-2071
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.71e-34
Family Retroviral integrase, catalytic domain 0.01
Further Details:      
 
Domain Number 3 Region: 1198-1298
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000045
Family Retroviral protease (retropepsin) 0.019
Further Details:      
 
Domain Number 4 Region: 387-425
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000488
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 
Weak hits

Sequence:  CBN08140
Domain Number - Region: 821-971
Classification Level Classification E-value
Superfamily Viral glycoprotein ectodomain-like 0.0207
Family Glycoprotein B-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN08140   Protein: CN32200   Gene: WBGene00146865
Sequence length 2301
Comment CN32200 WBGene00146865 status:Predicted
Sequence
MPDIPELDNTLTEIHDGEQVTSPAHWATPPTLATEDTLLNIRTAKITSEHLTTLRDAVAT
DLRRIHVQTNDLSSLTADRFKEIESRIRTLEGTTVSQGSGNSPQALGNGEPQGGSPPGTA
YTGNDSRNNLSGAVLPQAVAQMQTQSSFETFRSPRPIQTPSPTLSEPLPQDTPIPPRIPQ
KRSERFFISALGIKVPLNISPFSGAPHENFAAFLRTFEDYARASKSELTDKEKLAHFLTL
LNDYARDKAEEVREKNEEATFVEIVEHMRTTFQNPARAETEKQLLRQATQRDDENVDQFS
TRIRKLAQGAYPDKSRDYIQEKAKEAFVEGLPKNVRFHVKSAAPDTFQKAHDAAIKFEVL
LGQAIQGNTIIPQGLVVYPQAPAPAPSSPPQPQRSFPRSEGICYGCGRTGHFIAECRRLQ
NRQRNQGYRGQNRRQTFNNRFPNNGFQGFNNDPRDNAQDFGANFPNNQQRFNSGPRNFGR
ANQPSFPVANPQDAHQLPSQPQPNRRFVNSFAPLEEDAELQQLRDQVHNQQIQMEAIMRR
NNELAAAVIPTTPIRRVNAFSAMPKLGTLLTMFTLICLCNPSLAFAPLMCMPHTPETFLK
LPSSLNCSETGRDTLLTKPTPLQLLVLRDNTINYQVNGTMCKIVKRITRFSVNFIGVPWQ
ESTSKQIIVSTEACRNMRQFESCEHGDLVLKNGVYQTTNPHIIQWPSAPLSGFQGVQTVE
TSNCYMLPITVYGRFGHEAPSSAGGRMSSCKFASGSCVTKEGTAYIWKPITSQQCRYIKM
EVMDGYKSGNIWLSANKEFSLSFNNSSPVVFDCNQRLTLTDQGYAVATSSRVKRDVSDQG
NVTTFVTSNQLAAQLLANEMAVMERSARWFAHGFRTFCESSNSHAAATLAAVASNPTLAA
RKLTGKNNIQAKFIGENILAIKSCSTLTPDSFEFVAFDGKCYSKPTLRIRLPNNATVVTF
VDLNTRVITNRAHPVECGLVTNFEFIANKSLVSLNPFTLEITTNSDFNPQATPVASKISL
DPLEDEPLIFHNLMIGTESGNIQDRHLNEIWEVWQGSEEALEKIISRHSDPASGAPTQSG
IVEAVNYWSKAKYIAETAFFVWTLVCNTILTTLVTLVLFVEVVRVYISPWISASRSPPKP
DLEHLGISNQTVLDIEALATRSVTPAPIPDCTKHLRRIRSPPINVLSLTESRFITAQIPI
KVNGISFWALVDTGAGFTVASQDICPYIGISRMAQPTVEHAVGLGGNEVNMEGSATVTFE
IGSTVLSHKTHFTTGQCCPEGLYSYEFILGNDILSQLPKFHLDYANNCFVIGDEELPLGT
TGNDRTIFPSRVPIKYQAELEKHINSLLKSGRITESNTPWTSPIVLVKKKNGSLRVCLDF
RKLNEATIPDNFPLPRIDAILEKVGGSNYFSSLDMANGYLQLRLDPASSYKCGFITESKV
YAYTHLPFGLKSAASYFQRALRTVLGGLEDEVLVYIDDILIYSKTFEQHLETLRKVLHRF
RDFNLKASPKKCEFAKKSIVFLGHEISKNTYSPDKANVAKITEFPTPTNINEIRRFVGMA
GFFRKFIPNFSEISEPLTRLTRKERKFEWNLDQQGAFEKLRTSLSSEPVLGFPDYDRPFH
IFCDASAVAQGAALMQTRLHNEKDFFAIAYASRTLADTETRWPAIQVEMGAIIFALRQFR
PYVCMSKIILHSDHKPLTFLLQKSKTHDNLARWLVELQCYDISIIHIDGKKNTVADCLSR
ARENDDISEAVELKDIIEFPVCMKIDARANAATVIRKNKPSVTLDMVAEQEKDADILTIK
RILQNKILPETAPAALSSRIALSTLAANGTVLTKPFPTSKRDVLFVPKQLTSLIFEAFHE
SYLSGGHFNWRKTKAKIERRNFWPNMAKEVLERTKACPKCQAKNSPVPAYKERMVPVTTS
RVFQKVGLDLTGPLRTTAQGNKYILNIVCWFSKFIVSVPIPDARAETSARALLTEAVLKY
GAMTEIVTDNAKTFTCHAFDGFCNLLSIGNHKSIPYWSQGNGATERSFRTFHQLTSKYVN
KTHTDWDTILPALTFCYNTTVHSTTGETPFFLMHGRDPIFVIDQILNPAPNDLPSTESTE
IDDFRQEMVTNLREAWTAAKEHADKSREQFSKSHDSLAKPSDIRVGDRVMMKNVFSKKDL
SRKLVLPWVGQYRVIEVNRPEAVIQDINKPSKPARRVHLDQVKKFIEISGPAGTVPEQVS
SDGEDQTNHPEEPTSPQPTRPDSPVKDEADKAQPSGSPHVQIGKQPELEIPVTEPTPTEP
TPVARYNFRKDRKPPPRLAYE
Download sequence
Identical sequences G0PIT4
135651.CBN08140 CBN08140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]