SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN08966 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN08966
Domain Number 1 Region: 4-123
Classification Level Classification E-value
Superfamily PapD-like 2.88e-30
Family MSP-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN08966   Protein: CN25777   Gene: WBGene00147691
Sequence length 123
Comment CN25777 WBGene00147691 status:Predicted
Sequence
MAEKKQYISTEPADKVKFKADPQEEQKTYLKITNKSEMKQAFKVKCTRNDLFRIKPATGV
LDYNQTLTIMLIYRGGQEKLPSEERHHFGVYHIPAPEGCSCEGAWAEHYGPPQGEVKLRV
IWE
Download sequence
Identical sequences G0MFL4
135651.CBN08966 CBN08966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]