SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN09124 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN09124
Domain Number 1 Region: 29-121
Classification Level Classification E-value
Superfamily PapD-like 3.4e-19
Family MSP-like 0.011
Further Details:      
 
Weak hits

Sequence:  CBN09124
Domain Number - Region: 203-262
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0759
Family Myosin rod fragments 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN09124   Protein: CN13512   Gene: WBGene00147849
Sequence length 345
Comment CN13512 WBGene00147849 status:Predicted
Sequence
METKQSMDCILKDPSAQAKPVVPRLITVNPLNIIIEPSSGQIDKTLELKNIYPCRIAFRI
QTNGPTRYTVCPNKGFLSIGEKSMIQISMIDGSKYQSNHQFIVQAKPAPGDFADRKLIWK
QPNVLGILTNTRVKTMRPGQSLTKSQSKSPSAHLAPVDSSGANSPAPADSNESLVTPSVP
SWSKTANSIDHGKFADNINDLALKVKKAIAEKNTKTSEMVAVVNQIKSIEVELDRQAQLV
NELSERVKKGEMQYSNLVMHEQNLRSEMERYKPNCRGPSSAGIHDLHATVRSGSIKCYNC
DEYLLYLFALIFTRIIIVQLHLIASIHSLQARSLPLANDASAPQR
Download sequence
Identical sequences G0MZS2
135651.CBN09124 CBN09124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]