SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN09478 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN09478
Domain Number 1 Region: 147-245
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000171
Family Calponin-homology domain, CH-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN09478   Protein: CN18517   Gene: WBGene00148203
Sequence length 335
Comment CN18517 WBGene00148203 status:Partially_confirmed
Sequence
MSEEIKKVEEVAEEKAPEVPTTEPPTETPAPAVEEAPKTEEGAAEAAAPVAAEGEAAAAP
EEKKKSGGVARRFTFNKRWGKHRDAEAAAPKEPEAPKDPKEDILGWIAQQIPQAVHKANF
QVIDWVQKTAIAEEGDRKVIPGKDQATTRNQFLGFFKDGEMLNKLANALEPGAVEVAVAE
ENADAAAQKEVQKKNIDAFGAWAQKTLGTESAPVTSDDLLEKGKAGYSAVFQTLWQLGVQ
AKDKFDKEGFNVDTIVQLANSVVKSGLLNTILGFFRRNRQAAASVEEPKDDAAAAAEGAG
EAAKEEGAAGEVADTADEPVAVKQETSAPAAVAAN
Download sequence
Identical sequences G0NK19
CBN09478 135651.CBN09478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]