SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN09546 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN09546
Domain Number 1 Region: 103-167
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.96e-20
Family Skp1 dimerisation domain-like 0.00053
Further Details:      
 
Domain Number 2 Region: 23-92
Classification Level Classification E-value
Superfamily POZ domain 6.67e-16
Family BTB/POZ domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN09546   Protein: CN01536   Gene: WBGene00148271
Sequence length 179
Comment CN01536 WBGene00148271 status:Predicted
Sequence
MPKRNNPKRPQTSSSKPSVPVRLVHVIASDGSKLQADVRALLLSSTLAATIRELGYDKED
CVDMKPIPVNNVIGFTLRLVIEWCEKHKEDDPAIAQAEKDKKNIHIPSWDQNFLNRMPMP
HLFDLITAAYHLDITGLINYGCKSVANSAKGKSAEEMRELFGIPEPWEQPSTSTATWDD
Download sequence
Identical sequences G0P2D4
CBN09546 135651.CBN09546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]