SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN09594 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN09594
Domain Number 1 Region: 21-179
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-39
Family Calponin-homology domain, CH-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN09594   Protein: CN31503   Gene: WBGene00148319
Sequence length 192
Comment CN31503 WBGene00148319 status:Confirmed
Sequence
MSAFASSDRAEKSGIALEAQQKIYEKYDKNLAGEILQWVQDITGQSFDTHGDADNFVKVF
QDGSVLCNLANALKPGSVKKVNTSTMAFKKMENISFFLKFAEEFVQKSELFQTVDLYEGQ
DPNAVLICLASLARKSEKNFGRSGLGPKEAQGDRREWTDEQLKAGQNVIGLQMGSNKGAT
ASGLNMGNTRHM
Download sequence
Identical sequences G0NK83
CBN09594 135651.CBN09594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]