SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN09622 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN09622
Domain Number 1 Region: 17-86
Classification Level Classification E-value
Superfamily POZ domain 2.9e-18
Family BTB/POZ domain 0.0011
Further Details:      
 
Domain Number 2 Region: 99-165
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 9.29e-18
Family Skp1 dimerisation domain-like 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN09622   Protein: CN16411   Gene: WBGene00148347
Sequence length 169
Comment CN16411 WBGene00148347 status:Predicted
Sequence
MSVESTPVARAINVDSYCKIKSKDNKEFKVSLKAIQQSETLNSLLENMGYTAENADQQPA
IPVDNIDGATLELVFKWCEHYKGEPMPKEEDSNPKNVVIEEFDSNLLNIGDMELFDLICA
CDYLSIRKLLNIACRKVSDMAKGKTAEELRVIFGIPSNEEDEIAAAPAQ
Download sequence
Identical sequences G0MZK2
CBN09622 135651.CBN09622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]