SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN09933 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN09933
Domain Number 1 Region: 968-1101
Classification Level Classification E-value
Superfamily PRC-barrel domain 2.98e-53
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.0001
Further Details:      
 
Domain Number 2 Region: 169-289
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000017
Family Calponin-homology domain, CH-domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN09933   Protein: CN26771   Gene: WBGene00148658
Sequence length 1108
Comment CN26771 WBGene00148658 status:Predicted
Sequence
MDFALPALLAIEDYDENEGKLAASIRWLISRVYEEKRDMPDKLRDGVQRDENGHFQIDEA
VLGALCNGSLYAQAAAKIFKESALVTKGHGAVLAVLTDYGIDVLHEGNELVEEAQLVASS
PFNMSAHLAIIDALMMAHLRDVIPVSRVVEAVSRHTAVEPSEKPIDSVDALLFWINKICL
LVRDDVEREDPSTNIPEMEDLYEDISDGQCLCALLHWYRPQEMPIADISFNESATTRDCQ
YNLMLLQQFCHHHLGNDPFHFEIEDLLYLRDPLQMNVNAFLADLFVQFEPPVTPEPVETP
RIGPSPRRFVPASAIPDLRAANAAARSSMHNRNRPRMYNPPPPASHSQGPSRSVSRMSQD
SLFYSRPASIALQRRSMDQDSVTDFQTIRQGFENQAGTAQLNRYDGSVTASVRLAMEEKR
RKHDQQMAQMNSANETERLEKSKAAFFALRKNENDPANKGKEEWYDHFEAKLRALELRVG
LEDGEEGTQSARLNRASSQPSVVQGAGQPYPANYMTLPMNAAGQMTQSYIQHPQTPHDYY
MQQQLQQQQQQAQGNYASPSQLRNSLSNGMINHAGYMVQSMYPGDYQQQQMQMQQGQMPV
QPVGAYTPEGYFIPHHMQPIPAQQGYPQMQQAGMGFNGMAGNQPGFNLEGSPAQMGYIQT
ANKPLDMEMPMQQQQTQPLGQQPQQQMLPPNHNAFHLHSKSDDATQMQADPPLEINRNLT
NWGMTYKQEMPARSIPSRRTWQNETFIKNELDLVNSKDSVPHITDETTTQPEEAARRFPD
LMLDNHSENLAPGRGYSRHSDRDDLSTGRKSDDSPTDTPGRTLGDDDGSGENMEKIANER
RIAKKAALIAKTMKRKEEIETKVDIAEQRNAERRQVENEKKELALRKKVEKEQQRQKILE
EYKRKKLEKELGAELSARSTGRGHSQPPFIRTKSQMSEVTESRQNTPRMRGQSSVEQRVS
VSSLAEPTHKLFAKTVTKSNRGLINNALQFSVFPGAVNNATRQATITQMASSSCKHFLIL
FRDQKCQYRGLYTWDEVSDTAIKISGQGPPKCTEAMMNMMFKYDSGAKNFSQIATKHLSA
TIDGFAILDQYWQKPRIPHSGTPAHKNN
Download sequence
Identical sequences G0P4I5
135651.CBN09933 CBN09933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]