SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN11080 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN11080
Domain Number 1 Region: 98-165
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 8.37e-17
Family Skp1 dimerisation domain-like 0.00081
Further Details:      
 
Domain Number 2 Region: 18-85
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000251
Family BTB/POZ domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN11080   Protein: CN17301   Gene: WBGene00149805
Sequence length 192
Comment CN17301 WBGene00149805 status:Predicted
Sequence
MSKRKSASATDGAPELTYRVTSKEGKEFRVSEGAIEQCLTLHTMIAQLFYTPEDIETKDA
FPIQNVSSKTLKLIFKWCEHNKGKPIKDENDLTPPVVTPFDEELLKIDMDFLHEVIMAAN
FLNVAGLLDVACAKVAKMGEGLSPARMRVVFRVPTNEEDRAAQKAAADAAAAAAASAAAD
ATDVSGAGTSSG
Download sequence
Identical sequences G0MX20
CBN11080 135651.CBN11080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]