SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN11336 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CBN11336
Domain Number - Region: 373-403
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000251
Family Retrovirus zinc finger-like domains 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN11336   Protein: CN27393   Gene: WBGene00150061
Sequence length 565
Comment CN27393 WBGene00150061 status:Predicted
Sequence
MVGVKNKGGARPKKEPKVEVTSAAVPNVQVPTKKRVTKKVDAAVAASAAAPSTVQSSPLQ
VVTVGGVKGSGPLVLGTRKEALMIDPSEDLLQLDDDSLSIANDQGMLSETELDEMAHVEK
TEEVIASDKSDSNESVEPMDVSDGEQEKDFVREPSLPVEEIHQVQVQQPPQIQPPQVASR
GNELATQLPPEIWNSLQLLPELVLALDQIRKDFAASNQDQAQFVQKQELKKLLAPLKNLD
VIVPKLMNVEKLATDNLHATRGCAGRIDSHKEARLKESAAQLAHMKDVSQTVKYLTGTIK
SVKDYTARKTVELDKATARPGANKGQGSSSTSCASYAPGLEVMAAHGEMRDIARSYHQDQ
QVQAKAAAAAKPSYQPNKANRCIFCGLKGHPFMECPHYRDPLARRQVLLAQGKCWVCFDD
QCDSSATNCPVTRRRLCPKCSHMPHATRVHHESLCINPKSNQGVVSNNNAIMTAHQGFNE
QVAQSNEQFKRKRTKKQNGQSSNAAAKRSRHHSQSSQRTFVPPIRQISSDQPRDIEEDEN
TAQIVKKKKKSKKTNRKYNKNANDA
Download sequence
Identical sequences G0NY55
CBN11336 135651.CBN11336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]