SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN11462 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN11462
Domain Number 1 Region: 36-164
Classification Level Classification E-value
Superfamily PapD-like 0.0000000000043
Family MSP-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN11462   Protein: CN27957   Gene: WBGene00150187
Sequence length 243
Comment CN27957 WBGene00150187 status:Predicted
Sequence
MTPISGEFSQNMQRTPLVIHEGNIQKEFEKLHKDGKPILKTESKYVVFCGFPDLQGDRAC
VHMELRNETAKTFLFNIRTPISPNFFVKPHVGMVEPAKSVTLYFTFKAKCHRIPSDYCWI
YSIYHIPIDDKSVAWIKEDEFSSSNLRTVWNERGKDKNIENILHLSCKFDGKAKPKTECK
RHKINLSLFLNAAGEVMVEETGQKAEASSTPGNSQAQRTKKTPSLIDSTDELPKTANSEK
KIK
Download sequence
Identical sequences G0MUB3
135651.CBN11462 CBN11462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]