SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN11873 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN11873
Domain Number 1 Region: 8-78
Classification Level Classification E-value
Superfamily PapD-like 0.0000000000000133
Family MSP-like 0.0000562
Further Details:      
 
Domain Number 2 Region: 97-158
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000986
Family Myb/SANT domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN11873   Protein: CN32702   Gene: WBGene00150598
Sequence length 319
Comment CN32702 WBGene00150598 status:Predicted
Sequence
MNPWAMNRRTSNNKEYRISQVFGFIDPSGSKDVTITRTAGAPKEDKLVIHFGPAPADATD
AQAAFGAVTPAGTVTIPVSATEEKAKNIKKKKINKRKVRYTEDEDTILYEFVYRQIQKGI
HMNRLHLHSKNTWGKVHKYAKINRDGQSMCDRWRKHLQSLARLNELDDLQEKIKACLRKA
FKDENDSEIDDSSSVSRSSVSRSSVSRSSVSRSSEVKAASIKVSLEVTVKPVTSGTPQFK
SSQEHIPRLDAERVTSGTPQFKSSQEHIPRLDAERVTSGTPQFKSSQEHMPRLDAERVTS
GTPQFKSSQKHIPRMDAER
Download sequence
Identical sequences G0P5K7
CBN11873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]