SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN13001 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN13001
Domain Number 1 Region: 147-245
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000171
Family Calponin-homology domain, CH-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN13001   Protein: CN04602   Gene: WBGene00151726
Sequence length 334
Comment CN04602 WBGene00151726 status:Partially_confirmed
Sequence
MSEEIKKVEEVAEEKAPEVPTTEPPTETPAPAVEEAPKAEEGAAEAAAPAAAEGEAAAAP
EEKKKSGGVARRFTFNKRWGKHRDAEAAAPKEPEAPKDPKEDILGWIAQQIPQAVHKANF
QVIDWVQKTAIAEEGDRKVIPGKDQATTRNQFLGFFKDGEMLNKLANALEPGAVEVAVAE
ENADAAAQKEVQKKNIDAFGAWAQKTLGTESAPVTSDDLLEKGKAGYSAVFQTLWQLGVQ
AKDKFDKEGFNVDTIVQLANSVVKSGLLNTILGFFRRNRQAAASVEEPKDDAAAAEGAGE
AAKEEGAAGEVADTADEPVAVKQETSAPAAVAAN
Download sequence
Identical sequences G0PC27
CBN13001 135651.CBN13001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]