SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN13270 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN13270
Domain Number 1 Region: 268-351
Classification Level Classification E-value
Superfamily E set domains 8.31e-17
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.045
Further Details:      
 
Weak hits

Sequence:  CBN13270
Domain Number - Region: 358-399
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0366
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN13270   Protein: CN16160   Gene: WBGene00151995
Sequence length 486
Comment CN16160 WBGene00151995 locus:Cbn-unc-3 status:Predicted
Sequence
MSLTAPLRAGQMNFYDEPYNPVLNLHLAQSVKDENRTAWPIIDASNASVQISRAHFEKNP
PNNLRKSNFFHFVIALYDRNNHPIEIERTQFAGFVEKDKEVDGQDTRNGIHYRLSLVFQN
GLRAEQDLFVRLIDSVTKQAITYEGQDKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPS
DPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVLSSSARIDGPLLAVSDNMFVHNNS
KHGRRTKRTDASDDSEYSESADIPTSQPVIKALCPSEGWLQGGTQVVVIGENFFEGLQVS
FGTSSNYGELISPHAMRVTTPARHSSGPVDVTLSYKSKTYTRGTPLRFSYITLTEPSIEY
GFQRLQKLLPKYPGDPDRLPKDQILKRAAELAEALYNRTSTESLSTYYHSQFDTSTDYAS
RTHTSPRSTLPYGAGPPAISSAVYQTSYPAVNSTPAANFLNTQAGFAPFGTVNPFAATLQ
SSSRLS
Download sequence
Identical sequences G0MB66
135651.CBN13270 CBN13270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]