SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN13764 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN13764
Domain Number 1 Region: 9-89
Classification Level Classification E-value
Superfamily PapD-like 3.66e-19
Family MSP-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN13764   Protein: CN05830   Gene: WBGene00152489
Sequence length 138
Comment CN05830 WBGene00152489 status:Predicted
Sequence
MLYDFDDHNLFITPKIAYFPAAMGGASRHMMVNGSSHRIAVKIKCSDNELFRVSPVYTLL
EPGNAQRLQIVRDPGPAKTDKIVVIYKTTCASSARDAFECDLGAERKVIALIAKEDVTMS
IAPTTNLKSILRQSVQKS
Download sequence
Identical sequences G0MI57
135651.CBN13764 CBN13764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]