SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN13854 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN13854
Domain Number 1 Region: 5-126
Classification Level Classification E-value
Superfamily PapD-like 9.94e-37
Family MSP-like 0.000000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN13854   Protein: CN06383   Gene: WBGene00152579
Sequence length 127
Comment CN06383 WBGene00152579 status:Confirmed
Sequence
MAQSVPPGDIQTQPNAKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPC
GVLDPKEAVLLAVSCDAFAYGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKN
LPIEYNP
Download sequence
Identical sequences A0A2G5V5R2 B3GEJ6 G2J6N5
XP_002630618.1.8413 XP_002630630.1.8413 XP_002630743.1.8413 XP_002631457.1.8413 XP_002631464.1.8413 XP_002641632.1.8413 CBG02283 CBG02296 CBG02432 CBG09953 CBG20609 CBG20617 135651.CBN09306 135651.CBN13854 135651.CBN23285 135651.CBN26409 6238.CBG02283 6238.CBG02296 6238.CBG02432 6238.CBG09953 6238.CBG20609 6238.CBG20617 CBN09306 CBN13854 CBN23285 CBN26409 CBN29634 CBN29669 CBN30105 CBN30166 CBN30967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]