SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN13972 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN13972
Domain Number 1 Region: 185-262
Classification Level Classification E-value
Superfamily E set domains 0.0000014
Family Arrestin/Vps26-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN13972   Protein: CN11194   Gene: WBGene00152697
Sequence length 397
Comment CN11194 WBGene00152697 status:Partially_confirmed
Sequence
MFLRFSLILFLISFVFCEKIYPDDAFKITFDHENRTYYGREYVGVTVTHLRKDGDPDLKQ
VIINTISRVKTFRRSCEDIENCEIQDSTFVKLSTGHRFFYPFEDPVRIGLNTIKVKPAYI
SDAFHSSFEGINGYERHGMFIEIKTKDNRTQDFPIVYYNAIRGIDLSNNSLYEKPLVCEQ
KASIQGKDISVKIELPKNGWVYPETIPVKVTIENKSSWIVKQIIGEVVMSQTTYTRIGKK
DYELEFYKLKESDRVLANSTVASATWEPKKVLNFYDHFAKNIDIQNTFSQKETVTVPIQH
RSTSFLHSIELTDIPLIQNKHFVKVSVQLTNPAETSDLVIPTSLDCEFPVTFGIVPTENT
NVKFPTKTVPADKKYQAKLDGIENIVSYPSFEQLRKL
Download sequence
Identical sequences G0PA29
CBN13972 135651.CBN13972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]