SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN14354 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN14354
Domain Number 1 Region: 279-391
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.5e-18
Family Calponin-homology domain, CH-domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN14354   Protein: CN30203   Gene: WBGene00153079
Sequence length 472
Comment CN30203 WBGene00153079 status:Partially_confirmed
Sequence
MSLFSRSLNRFTGTASETGPPVNEQNITYRKKLSTVSTSLKGDDGPVAESPRNLYTRPNV
VPLRRKVFDESDGAMISTSSGQTPVELKAAEIRRMNSKKEASLKKEENHAPPPPPIEGTS
ATLAPQTSKTNQKKSRTSTSSLASVFRSRASSPIERMRKFIGRSSSKQPKEISAPSPPST
STSSEPIPNEQQFLVQELEKVRYQLAQTQLELSEQNKKLNKVQMVSCSQQSEPILITNIG
TMTEEIVEEKKRNNVDKENMHPDVICIEDSETSKIQNLKQEIAALKKENAEQKEDFRRTR
KDFILILKEAVLRKDEAEHKLETISKSISDEDDWVTLMSQHRHALRRNVLLMWVQKKLEP
YSDQLTVSNFSSDWTDCRAFCALLYDLFPQTMPDVTVSPIVGDCISRCRRTFQFLEIPFD
ERALGIATSPSQMTDSGADDSSSVSSVYNGLTDWRYVMNTVFVLYKRGVLQK
Download sequence
Identical sequences G0MEJ7
135651.CBN14354 CBN14354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]