SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN14566 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN14566
Domain Number 1 Region: 18-140
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-33
Family Calponin-homology domain, CH-domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN14566   Protein: CN02183   Gene: WBGene00153291
Sequence length 142
Comment CN02183 WBGene00153291 status:Partially_confirmed
Sequence
MANRTTAGGIGFAVRQKQESKFIKEEAALLLEWIKKVSGENISTSGERDNFYNLLKDGTL
LCKVANGIEAGSVKKVQKPISTFACMENINAFVEFAKKQGVPNEETFQSVDLTEGRDLFS
VCVTLLSLGRILQKAGKTNPFA
Download sequence
Identical sequences G0PDR7
135651.CBN14566 135651.CBN19153 CBN14566 CBN19153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]