SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN14798 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN14798
Domain Number 1 Region: 86-151
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.53e-18
Family Skp1 dimerisation domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 12-72
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000141
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN14798   Protein: CN21019   Gene: WBGene00153523
Sequence length 163
Comment CN21019 WBGene00153523 status:Partially_confirmed
Sequence
MSAETAAPEDKFFVVSDDDQRFEISNEAIKMSATLQNILQGVESGNMKCLPIQSVNGKVL
ELIVKWCEHHKHLDEIDPLDLANPKNLKMDEWDVKFFDGMEDMVLFELINAVNFLDIKKL
FVYACRIVSDMAKGLTSDKMRERFGIATDEEDAAAAAGAAIAQ
Download sequence
Identical sequences G0NCH6
135651.CBN14798 CBN14798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]