SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN15469 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN15469
Domain Number 1 Region: 106-175
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.88e-23
Family Skp1 dimerisation domain-like 0.00023
Further Details:      
 
Domain Number 2 Region: 30-93
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000286
Family BTB/POZ domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN15469   Protein: CN13922   Gene: WBGene00154194
Sequence length 189
Comment CN13922 WBGene00154194 status:Predicted
Sequence
MADEAAPLVAALGAEPAAPAADAAAPEIFYQIESKDNQVFRFSELAIQQADTLNIMVQTM
GYDAKGIIPLENIDGDTLNLVFKWCEHHAGEPIPEDDEDVPQNVVIPPWDEELMKIDNKR
LFNLICAANYLNVKQLLNVACKKVANMVTGRTPEEMRIIFGIPSDEEDEAATAAAKSARE
DPQEGPSNS
Download sequence
Identical sequences G0PA30
CBN15469 135651.CBN15469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]