SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN15959 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN15959
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily PapD-like 1.13e-36
Family MSP-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN15959   Protein: CN02915   Gene: WBGene00154684
Sequence length 249
Comment CN02915 WBGene00154684 status:Predicted
Sequence
MSEKHSLLQVTPSRELVFTGPFTDVVTSHMTLKNTTSNPVCFKVKTTAPKQYCVRPNSGL
LKTGDSKQITVMLQPLEGIPSDAGRHKFMVQSCVAPAEDIVDLEAIWKIVDPTELTYSKL
MVTFVDKKNPASGDDNKTMMMHGHEETFASAGQAQELGSSYSASHSQQDGTVASLRKSLK
STVDEKEELQKKILGLEQEIEVMLKKNRKLQQTQSNGGLVDGPYPTLQVVLFAFAALLIG
LIIGSLLRY
Download sequence
Identical sequences G0NPZ2
CBN15959 135651.CBN15959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]