SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN16699 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN16699
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily PapD-like 1.39e-36
Family MSP-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN16699   Protein: CN19680   Gene: WBGene00155424
Sequence length 249
Comment CN19680 WBGene00155424 status:Partially_confirmed
Sequence
MSEKHSLLQVTPSRELVFTGPFTDVVTAHMTLKNTTSNPVCFKVKTTAPKQYCVRPNSGL
LKTGDSKQITVMLQPLEGIPSDAGRHKFMVQSCVAPAEDIVDLEAIWKIVDPTELTYSKL
MVTFVDKKNPASGDDNKTMMMHGHEETFASAGQAQELGSSYSASHSQQDGTVASLRKSLK
STVDEKEELQKKILGLEQEIEVMLKKNRKLQQTQSNGGLVDGPYPTLQVVLFAFAALLIG
LIIGSLLRY
Download sequence
Identical sequences G0NLG1
135651.CBN16699 CBN16699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]