SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN17169 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN17169
Domain Number 1 Region: 205-283
Classification Level Classification E-value
Superfamily E set domains 0.00000364
Family Arrestin/Vps26-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN17169   Protein: CN02498   Gene: WBGene00155894
Sequence length 418
Comment CN02498 WBGene00155894 status:Predicted
Sequence
MFLRFSPICFLISFVLCEKIYPEDAFKITFDHENRTYYGREYVGVTVTHLRKDGDPDLKQ
VIINTISRVKTFRRSCEDIENCEIQDSTYVKLSTGHRFFYPFENPVRIGLNTIKVKPAYI
GDAFHSSFEGEGILENKNFSKAMGEFDFFKGINGYERHGMFIEIKTKDNRTQDFPIVYYN
AIRGIDLSNNSTYENSLVCEQKSTIHGKEVSARVELPKNGWVYPETIPVKVTIENKSSWI
VKQIIGEVVMSQTTYTRVGKKDYELERYKFKESDRVLANSTVASTEWKPKKGSKLLRSYQ
KNINFQNTFSQKETVRVPIQHRSTSFLHSIELTDIPLLQNRHFVKISVQLTNPSETSELD
IPSSLDCEFPVTFGIVPTANTNVKFPTKTVPADKKYQAKLDGIENIVSYPSFEQLRKL
Download sequence
Identical sequences G0MQ99
CBN17169 135651.CBN17169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]