SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN18672 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN18672
Domain Number 1 Region: 4-135
Classification Level Classification E-value
Superfamily PapD-like 1.44e-30
Family MSP-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN18672   Protein: CN10063   Gene: WBGene00157397
Sequence length 159
Comment CN10063 WBGene00157397 status:Predicted
Sequence
MPLPNKAGEPEFKLKTDPADRVVIKYKKNDESTVTLTITNITKDRVCYKVKCTDNQIFRV
RPPMGFIKPGETVPVKITLKSKEDLDPTRHFFAIYHITFSDLKEKDPRAAWKDGAKPDGV
LRLQAHLETEDKADEKKDEKKEEKKDEDKKDDKKDDKKE
Download sequence
Identical sequences G0ML72
CBN18672 135651.CBN18672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]