SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN19269 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN19269
Domain Number 1 Region: 104-171
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.28e-20
Family Skp1 dimerisation domain-like 0.00036
Further Details:      
 
Domain Number 2 Region: 31-93
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000051
Family BTB/POZ domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN19269   Protein: CN29566   Gene: WBGene00157994
Sequence length 181
Comment CN29566 WBGene00157994 status:Partially_confirmed
Sequence
MVKSPKSNKKGGKAVKVNNTVAVNENLDLIYTLISSDGEQFQADGHSLKLSKVLSLAAKC
LQSTETTIHVEKVKGDTLKRVLEWCENHKDDGPYVSKCGPGLRLPHWDFRWLKSLDNQQL
FDLITATNDLQMKQLMDYSCKTVANMAKGKSPEQLRQIFGILTDEEEAELALHEPGPSNA
N
Download sequence
Identical sequences G0PMQ5
CBN19269 135651.CBN19269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]