SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN20927 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN20927
Domain Number 1 Region: 12-81
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000209
Family BTB/POZ domain 0.0014
Further Details:      
 
Domain Number 2 Region: 92-140
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000000131
Family Skp1 dimerisation domain-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN20927   Protein: CN12989   Gene: WBGene00159652
Sequence length 185
Comment CN12989 WBGene00159652 status:Predicted
Sequence
MSFRAAAPDAIYYRVEARNGEEFKVSRLAIQQSEVLHRLVEAMGYTLDDVEMKEAIPIEN
IDAETLKLIFQWCEHHKGEPIPEYDLGFVPENVVIPGFDAKLMDIDLEKVFNLMDAANYL
GIKQLFAVSSTKANIMLQEEERAPQEDAAQEEAAQEDADAENGEQRISVSAYLVDKFHRF
LSFFQ
Download sequence
Identical sequences G0MQF9
CBN20927 135651.CBN20927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]