SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN20993 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN20993
Domain Number 1 Region: 5-126
Classification Level Classification E-value
Superfamily PapD-like 4.71e-37
Family MSP-like 0.000000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN20993   Protein: CN07495   Gene: WBGene00159718
Sequence length 127
Comment CN07495 WBGene00159718 status:Confirmed
Sequence
MAQSVPPGDIQTQPNAKIVFNAPYDDKHTYHIKVINSSARRIGFGIKTTNMKRLGVDPPC
GVLDPKEAVLLAVSCDAFAYGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKN
LPIEYNP
Download sequence
Identical sequences B6VBC6
CBN20993 135651.CBN20993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]